Structure of PDB 6tvq Chain AaA Binding Site BS01

Receptor Information
>6tvq Chain AaA (length=38) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NNLLRAIEAQQHLLQLTVWGIKQLQARILAVERYLKDQ
Ligand information
>6tvq Chain BBB (length=25) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NNMTWMEWDREINNYTSLIHSLIEE
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6tvq Systematic Evaluation of Fluorination as Modification for Peptide-Based Fusion Inhibitors against HIV-1 Infection.
Resolution1.45 Å
Binding residue
(original residue number in PDB)		Q612 Q616 I622 K623 Q626 K637 D638 Q639
Binding residue
(residue number reindexed from 1)		Q11 Q15 I21 K22 Q25 K36 D37 Q38
Enzymatic activity
Enzyme Commision number ?
External links