Structure of PDB 8off Chain Aa Binding Site BS01

Receptor Information
>8off Chain Aa (length=106) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEI
LELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQ
AVLLPK
Ligand information
>8off Chain J (length=144) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gagaatcccggtgccgaggccgctcaattggtcgtagacagctctagcac
cgcttaaacgcacgtacgcgctgtccgccgcgttttaaccgccaagggga
ttactccctagtctccaggcacgtgtcagatatatacatcctgt
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8off BRCA1-BARD1 combines multiple chromatin recognition modules to bridge nascent nucleosomes
Resolution3.4 Å
Binding residue
(original residue number in PDB)
R18 R78
Binding residue
(residue number reindexed from 1)
R5 R65
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0019899 enzyme binding
GO:0030527 structural constituent of chromatin
GO:0031492 nucleosomal DNA binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0008150 biological_process
GO:0031507 heterochromatin formation
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0070062 extracellular exosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8off, PDBe:8off, PDBj:8off
PDBsum8off
PubMed37823591
UniProtP0C0S8|H2A1_HUMAN Histone H2A type 1 (Gene Name=H2AC11)

[Back to BioLiP]