Structure of PDB 7p5x Chain AY Binding Site BS01

Receptor Information
>7p5x Chain AY (length=124) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VSKVERLMNLVIALLSTRTYLPAEKIRTTVAGYADSPSDEAFSRMFERDK
NELRDLGIPLETGRVSKWDSTEGYRINRDSYALPPIGLTADEAAAVAVAT
QLWQSPELVTATQNAVLKLRAAGV
Ligand information
>7p5x Chain AO (length=43) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
acttgtcggtggtctgctctaacgtcacggccaaccgatcgga
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7p5x Transcriptional control of mycobacterial DNA damage response by sigma adaptation.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		R8 A43 R50
Binding residue
(residue number reindexed from 1)		R6 A41 R48
Enzymatic activity
Enzyme Commision number ?
External links