Structure of PDB 6fxc Chain AY Binding Site BS01

Receptor Information
>6fxc Chain AY (length=59) Species: 273036 (Staphylococcus aureus RF122) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKQGIHPEYHQVIFLDTTTNFKFLSGSTKTSSEMMEWEDGKEYPVIRLDI
SSDSHPFYT
Ligand information
>6fxc Chain AB (length=115) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ucuggugacuauagcaaggaggucacaccuguucccaugccgaacacaga
aguuaagcuccuuagcgucgaugguagucgaacuuacguuccgcuagagu
agaacguugccaggc
<<<<<<<<<....<<<<<<<<.....<<<<<...............>>>.
.>>....>>>>>>.>>.<<......<<<.<<<<....>>>>.>>>.....
.>>..>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6fxc The cryo-EM structure of hibernating 100S ribosome dimer from pathogenic Staphylococcus aureus.
Resolution6.76 Å
Binding residue
(original residue number in PDB)		M1 K2 I5 H6
Binding residue
(residue number reindexed from 1)		M1 K2 I5 H6
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6fxc, PDBe:6fxc, PDBj:6fxc
PDBsum6fxc
PubMed28959035
UniProtQ2YUN3|RL31B_STAAB Large ribosomal subunit protein bL31B (Gene Name=rpmE2)

[Back to BioLiP]