Structure of PDB 8fiz Chain AV Binding Site BS01

Receptor Information

>8fiz Chain AV (length=69) Species: 562 (Escherichia coli)

MKKDIHPKYEEITASCSCGNVMKIRSTVGHDLNLDVCSKCHPFFTGKQRD
VATGGRVDRFNKRFNIPGS

Ligand information

>8fiz Chain BC (length=120)

ugccuggcggccguagcgcgguggucccaccugaccccaugccgaacuca
gaagugaaacgccguagcgccgaugguaguguggggucuccccaugcgag
aguagggaacugccaggcau

<<<<<<<<<<.....<<<<<<<<....<<<<<<<.............>>>
>..>>>...>>>>>>.>>.<<.......<<<<<<<<...>>>>>>>>...
....>>...>>>>>>>>>>.

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8fiz A trailing ribosome speeds up RNA polymerase at the expense of transcript fidelity via force and allostery.
• Resolution: 3.8 Å
• Binding residue (original residue number in PDB): M1 H6
• Binding residue (residue number reindexed from 1): M1 H6

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0008270 zinc ion binding
• GO:0019843 rRNA binding
• GO:0046872 metal ion binding

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0006413 translational initiation
• GO:1904689 negative regulation of cytoplasmic translational initiation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8fiz, PDBe:8fiz, PDBj:8fiz
• PDBsum: 8fiz
• PubMed: 36931247
• UniProt: P0A7M9|RL31_ECOLI Large ribosomal subunit protein bL31 (Gene Name=rpmE)