Structure of PDB 6yft Chain AU Binding Site BS01

Receptor Information
>6yft Chain AU (length=113) Species: 1923567 (Wenzhou levi-like virus 1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
STFSSLVIGSNTFIPTAPGYYSLSTRGFSDPRNQIKISGGKFNAKTGRVT
AAVSRLWETDVTVAGLPVRSAAEVAIIMTLGRGITATNADVLLSDLNTLL
DPARLDQILQGGF
Ligand information
>6yft Chain RG (length=20) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
auauauauauuauauauaua
<<<<<<<<<.>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6yft Three-dimensional structure of 22 uncultured ssRNA bacteriophages: Flexibility of the coat protein fold and variations in particle shapes.
Resolution3.5 Å
Binding residue
(original residue number in PDB)
Y20 K36 S38 K41 N43 T50 A52
Binding residue
(residue number reindexed from 1)
Y20 K36 S38 K41 N43 T50 A52
External links