Structure of PDB 7zrz Chain AP1 Binding Site BS01

Receptor Information
>7zrz Chain AP1 (length=184) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MLVVEVANGRSLVWGAEAVQALRERLGVGGRTVGALPRGPRQNSRLGLPL
LLMPEEARLLAEIGAVTLVSAPRPLDWRVQSKDWPHAGRPAHELRYSIYR
DLWERGFFLSAAGKFGGDFLVYPGDPLRFFAHYIAQCWAPEDTIPLQDLV
AAGRLGTSVRKTLLLCSPQPDGKVVYTSLQWASL
Ligand information
>7zrz Chain ZN1 (length=77) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggcucuguggcgcaauggauagcgcauuggacuucuagagaaauucaaag
guuguggguucgagucccaccagaguc
<<<<<<<..<<<<........>>>>.<<<<.<<<...>>>....>>>>..
...<<<<<.......>>>>>>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7zrz Structural basis of substrate recognition by human tRNA splicing endonuclease TSEN.
Resolution3.09 Å
Binding residue
(original residue number in PDB)		R41 S44 K239 Y247 F255 R285
Binding residue
(residue number reindexed from 1)		R41 S44 K114 Y122 F130 R160
Enzymatic activity
Enzyme Commision number 4.6.1.16: tRNA-intron lyase.
Gene Ontology
Molecular Function
GO:0000213 tRNA-intron endonuclease activity
GO:0003676 nucleic acid binding
Biological Process
GO:0000379 tRNA-type intron splice site recognition and cleavage
GO:0006388 tRNA splicing, via endonucleolytic cleavage and ligation
Cellular Component
GO:0000214 tRNA-intron endonuclease complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7zrz, PDBe:7zrz, PDBj:7zrz
PDBsum7zrz
PubMed37231152
UniProtQ9BSV6|SEN34_HUMAN tRNA-splicing endonuclease subunit Sen34 (Gene Name=TSEN34)

[Back to BioLiP]