Structure of PDB 8apo Chain AI Binding Site BS01

Receptor Information
>8apo Chain AI (length=64) Species: 353565 (Polytomella magna) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VVFKTTGGKAWNPPGGLKPLTNTQKRSRKENLQILLRNLSVLKLAAENQP
EVTVNLFSPLKFMH
Ligand information
>8apo Chain A4 (length=73) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uaagucagacgcaaagcuacaagguuucgcgucaaaaggaaaaaaguccg
ccagcgaggcuaagguacauaaa
.......<<<<<.<<<<......>>>>.>>>>>....<<<......>>>.
.......................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8apo Structure of the mitochondrial ribosome from Polytomella magna with tRNAs bound to the A and P sites
Resolution3.2 Å
Binding residue
(original residue number in PDB)		V9 K12 T14 G16 W19 R34 S35
Binding residue
(residue number reindexed from 1)		V1 K4 T6 G8 W11 R26 S27
External links