Structure of PDB 4v6u Chain AH Binding Site BS01

Receptor Information

>4v6u Chain AH (length=215) Species: 186497 (Pyrococcus furiosus DSM 3638) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MAKPLNERFFIPHEIKVMGRWSTEDVEVRDPSLKPYINLEPRLLPHTHGR
HAKKHFGKANVHIVERLINKIMRSGGSHYKVAGHFMRREHRSLNSKKVKA
YEVVKEAFKIIEQRTGKNPIQVLVWAIENAAPREDTTSVMFGGIRYHVAV
DISPMRRLDVALRNIALGASAKCYRNKMSFAEALAEEIILAANKDPKSYA
YSKKLEIERIAESSR

Ligand information

>4v6u Chain A1 (length=77) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ggggcgguagcucagccugggagagcaccggacugaagauccgggugucg
gggguucaaaucccccccgccccacca

<<<<<<<..<<<<.........>>>>.<<<<<.......>>>>>.....<
<<<<.......>>>>>>>>>>>>....

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4v6u Promiscuous behaviour of archaeal ribosomal proteins: Implications for eukaryotic ribosome evolution.
Resolution	6.6 Å
Binding residue (original residue number in PDB)	S138 E206 I210
Binding residue (residue number reindexed from 1)	S138 E206 I210

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4v6u, PDBe:4v6u, PDBj:4v6u
PDBsum	4v6u
PubMed	23222135
UniProt	Q8U0M8\|RS7_PYRFU Small ribosomal subunit protein uS7 (Gene Name=rps7)

[Back to BioLiP]