Structure of PDB 7d5t Chain AG Binding Site BS01

Receptor Information
>7d5t Chain AG (length=48) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DEEDIALEFINGEKKDKLVNMNSFTSMFDNIQNVQMDTFFDRVMKVLT
Ligand information
>7d5t Chain 3A (length=167) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ucgacguacuucaaggaucauuucuauaggaaucgucacucuuugacucu
ucccaacuugguugaugagucccauaaccuuuguaccccagagugagaaa
uugccguugcauuuuauggcgcgaugaucuugacccauggguggguacaa
auggcagucugacaagu
..................................................
.....<<<<<.................<<<<<<<<<<<....<...<...
..<<<<..........>>>>.>......>..<..<<..>>.>>>>>>>>>
>.>>........>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7d5t Cryo-EM structure of 90S preribosome with inactive Utp24 (state F1)
Resolution6.0 Å
Binding residue
(original residue number in PDB)		N868 M869 N870
Binding residue
(residue number reindexed from 1)		N20 M21 N22
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0005515 protein binding
GO:0034511 U3 snoRNA binding
Biological Process
GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006364 rRNA processing
GO:0030490 maturation of SSU-rRNA
GO:0042254 ribosome biogenesis
GO:0045943 positive regulation of transcription by RNA polymerase I
GO:2000234 positive regulation of rRNA processing
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0005777 peroxisome
GO:0030686 90S preribosome
GO:0032040 small-subunit processome
GO:0033553 rDNA heterochromatin
GO:0034455 t-UTP complex
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7d5t, PDBe:7d5t, PDBj:7d5t
PDBsum7d5t
PubMed
UniProtQ02931|UTP17_YEAST NET1-associated nuclear protein 1 (Gene Name=NAN1)

[Back to BioLiP]