Structure of PDB 8urh Chain AF Binding Site BS01

Receptor Information
>8urh Chain AF (length=82) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RVTVQDAVEKIGNRFDLVLVAARRARQMQVGGKDPLVPEENDKTTVIALR
EIEEGLINNQILDVRERQEQQEQEAAELQAVT
Ligand information
>8urh Chain 7 (length=37) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
auguuuuuuuuuuuuuuuuuuuugauuuggugagagg
.....................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8urh Escherichia coli transcription-translation coupled complex class A (TTC-A) containing RfaH bound to ops signal, mRNA with a 21 nt long spacer, and fMet-tRNAs in E-site and P-site of the ribosome
Resolution5.7 Å
Binding residue
(original residue number in PDB)		V83 T84
Binding residue
(residue number reindexed from 1)		V81 T82
Enzymatic activity
Enzyme Commision number 2.7.7.6: DNA-directed RNA polymerase.
Gene Ontology
Molecular Function
GO:0001000 bacterial-type RNA polymerase core enzyme binding
GO:0003677 DNA binding
GO:0003899 DNA-directed 5'-3' RNA polymerase activity
GO:0016779 nucleotidyltransferase activity
GO:0034062 5'-3' RNA polymerase activity
Biological Process
GO:0006351 DNA-templated transcription
GO:0006352 DNA-templated transcription initiation
GO:0006879 intracellular iron ion homeostasis
GO:0009408 response to heat
GO:0031564 transcription antitermination
GO:0032784 regulation of DNA-templated transcription elongation
GO:0036460 cellular response to cell envelope stress
GO:0042128 nitrate assimilation
GO:0044780 bacterial-type flagellum assembly
GO:0048870 cell motility
GO:0065003 protein-containing complex assembly
GO:0071973 bacterial-type flagellum-dependent cell motility
GO:0090605 submerged biofilm formation
GO:2000142 regulation of DNA-templated transcription initiation
Cellular Component
GO:0000345 cytosolic DNA-directed RNA polymerase complex
GO:0000428 DNA-directed RNA polymerase complex
GO:0005829 cytosol
GO:0008023 transcription elongation factor complex
GO:0030880 RNA polymerase complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8urh, PDBe:8urh, PDBj:8urh
PDBsum8urh
PubMed39117885
UniProtP0A800|RPOZ_ECOLI DNA-directed RNA polymerase subunit omega (Gene Name=rpoZ)

[Back to BioLiP]