Structure of PDB 8fxp Chain AD Binding Site BS01

Receptor Information
>8fxp Chain AD (length=137) Species: 2557550 (Agrobacterium phage Milano) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MNFNVGVDFPSFIAWDGEESFPVKVDGFNQFGFTFKTIAALTAATTFNIF
YHEPSDADPCVPGPAIRVPEVPFCDTVLLSEDGLAAVTLPETVTPDSFCA
GTVPCMNGQWISIAPATGSETNAANVQITVTMKGATR
Ligand information
>8fxp Chain AR (length=28) Species: 2557550 (Agrobacterium phage Milano) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
MVKLNCRPLCQAPTASRLVSPPCFICRG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8fxp Neck and capsid architecture of the robust Agrobacterium phage Milano.
Resolution4.04 Å
Binding residue
(original residue number in PDB)
A86 V87 D96 S97 F98 A100
Binding residue
(residue number reindexed from 1)
A86 V87 D96 S97 F98 A100
Enzymatic activity
Enzyme Commision number ?
External links