Structure of PDB 6r6g Chain AC Binding Site BS01

Receptor Information

>6r6g Chain AC (length=105) Species: 9615 (Canis lupus familiaris) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DRFICIYPAYLNNKKTIAEGRRIPISKAVENPTATEIQDVCSAVGLNVFL
EKNKMYSREWNRDVQYRGRVRVQLKQEDGSLCLVQFPSRKSVMLYAAEMI
PKLKT

Ligand information

>6r6g Chain AF (length=206) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gccgggcgcgguggcgcgcgccuguagucccagcuacucgggaggcugag
gcuggaggaucgcuugacuaaguucggcaucaauauggugaccucccggg
agcgggggaccaccagguugccuaaggaggggugaaccggcccaggucgg
aaacggagcaggucaaaacucccgugcugaucaguaguuuagcgagaccc
cgucuc

<<<<<<<<<<..(((.>>>>>>>....<<<<.)))....>>>>>>>.<<<
<<.<<....<<<<<.<<<<.<..<<<<<<<<<<<.<<<<<..<<<<<<..
..>>>>>>..>>>>>.>>>>........<<<<<.....<<<<....<<<.
...>>>....>>>>...>>>>>.>>>>>>>....>>>>>.>>>>>...>>
.>>>>>

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6r6g Structural and mutational analysis of the ribosome-arresting human XBP1u.
Resolution	3.7 Å
Binding residue (original residue number in PDB)	R14 F15 C17 Y19 Y22 T28 I29 R33 P36 I37 K66 M67 Y68 S69 R70 R101
Binding residue (residue number reindexed from 1)	R2 F3 C5 Y7 Y10 T16 I17 R21 P24 I25 K54 M55 Y56 S57 R58 R89

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0008312	7S RNA binding

	Biological Process
GO:0006614	SRP-dependent cotranslational protein targeting to membrane

	Cellular Component
GO:0048500	signal recognition particle

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6r6g, PDBe:6r6g, PDBj:6r6g
PDBsum	6r6g
PubMed	31246176
UniProt	J9PAS6\|SRP19_CANLF Signal recognition particle 19 kDa protein (Gene Name=SRP19)

[Back to BioLiP]