Structure of PDB 8ois Chain AB Binding Site BS01

Receptor Information
>8ois Chain AB (length=279) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ERPPRRKALPPRTEKMAVDQDWPSVYPVAAPFKPSAVPLPVRMGYPVKKG
VPMAKEGNLELLKIPNFLHLTPVAIKKHCEALKDFCTEWPAALDSDEKCE
KHFPIEIDSTDYVSSGPSVRNPRARVVVLRVKLSSLNLDDHAKKKLIKLV
GERYCKTTDVLTIKTDRCPLRRQNYDYAVYLLTVLYHESWNTEEWEKSKT
EADMEEYIWENSSSERNILETLLQMKAAEKNMEINKEELLGTKEIEEYKK
SVVSLKNEEENENSISQYKESVKRLLNVT
Ligand information
>8ois Chain Bd (length=26) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
LQSRKEYEQELSDDLHVERYRQFWTR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ois Molecular basis of translation termination at noncanonical stop codons in human mitochondria.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		Y224 T227 H231 E232 N235
Binding residue
(residue number reindexed from 1)		Y180 T183 H187 E188 N191
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005763 mitochondrial small ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ois, PDBe:8ois, PDBj:8ois
PDBsum8ois
PubMed37141370
UniProtP82673|RT35_HUMAN Small ribosomal subunit protein mS35 (Gene Name=MRPS35)

[Back to BioLiP]