Structure of PDB 8apo Chain AB Binding Site BS01

Receptor Information
>8apo Chain AB (length=50) Species: 353565 (Polytomella magna) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKRGMTYQPSRKKRINKHGMEKRLGTEDGRLTILRRLEKGRWRLTVDMFR
Ligand information
>8apo Chain A1 (length=109) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ugugaccguuagcgcauaguacaguaauggaagugcauaaaccaaauuaa
aggcuuaaauuaaaaauaaaauggcuggugcaauggcacaaaaaauaaga
aaguuuaaa
<<<<.<<..............<<....>>....<<<<....<<<......
.....................>>>....>>>>..>>>>>>..........
.........
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8apo Structure of the mitochondrial ribosome from Polytomella magna with tRNAs bound to the A and P sites
Resolution3.2 Å
Binding residue
(original residue number in PDB)
Y120 R127 H131 R136 R148 R149 K152 G153 R154 W155
Binding residue
(residue number reindexed from 1)
Y7 R14 H18 R23 R35 R36 K39 G40 R41 W42
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Thu Apr 17 20:20:40 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '8apo', asym_id = 'AB', bs = 'BS01', title = 'Structure of the mitochondrial ribosome from Polytomella magna with tRNAs bound to the A and P sites'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='8apo', asym_id='AB', bs='BS01', title='Structure of the mitochondrial ribosome from Polytomella magna with tRNAs bound to the A and P sites')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '8apo', asym_id = 'AB'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='8apo', asym_id='AB')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>