Structure of PDB 8s1r Chain AAA Binding Site BS01

Receptor Information
>8s1r Chain AAA (length=109) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPLGSDYIIKEKTVLLQKKDSEGFGFVLRGAKAQTPIEEFTPTPAFPALQ
YLESVDEGGVAWRAGLRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLM
VKVVMVTRH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8s1r Biophysical and structural analyses of the interaction between the SHANK1 PDZ domain and an internal SLiM.
Resolution1.979 Å
Binding residue
(original residue number in PDB)		E672 G673 F676 V677 L678 R679 G680 K682 Y701 E703 D706 H735 R736
Binding residue
(residue number reindexed from 1)		E22 G23 F26 V27 L28 R29 G30 K32 Y51 E53 D56 H85 R86
External links
PDB RCSB:8s1r, PDBe:8s1r, PDBj:8s1r
PDBsum8s1r
PubMed38899489
UniProtQ9Y566|SHAN1_HUMAN SH3 and multiple ankyrin repeat domains protein 1 (Gene Name=SHANK1)

[Back to BioLiP]