Structure of PDB 7qcq Chain AAA Binding Site BS01

Receptor Information
>7qcq Chain AAA (length=110) Species: 9844 (Lama glama) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GGVFVQSGGSLRLSCAASGATSTFDGMGWFRQAPGKEREFVSAISYEQGS
YTYYADSVKGRFTISRDNSKNMVYLQMNSLRAEDTATYYCAPAYEGDLYA
FQGTQVTVSS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7qcq Inhibition of Tau seeding by targeting Tau nucleation core within neurons with a single domain antibody fragment.
Resolution1.7 Å
Binding residue
(original residue number in PDB)		R47 F49 Y62 E104 G105 D106 L107 Y108 A109 F110
Binding residue
(residue number reindexed from 1)		R38 F40 Y53 E95 G96 D97 L98 Y99 A100 F101
External links