Structure of PDB 7q4t Chain AAA Binding Site BS01

Receptor Information
>7q4t Chain AAA (length=187) Species: 757342 (Pseudomonas phage JG004) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HMALTEQDFQSAADDLGVDVASVKAVTKVESRGSGFLLSGVPKILFERHW
MFKLLKRKLGHDPEINDVCNPKAGGYLGGQAEHERLDKAVKMDRDCALQS
ASWGLFQIMGFHWEALGYASVQAFVNAQYASEGSQLNTFVRFIKINPAIH
KALKSKNWAEFAKRYNGPDYKKNNYDVKLAEAYQSFK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7q4t Monomodular Pseudomonas aeruginosa phage JG004 lysozyme (Pae87) contains a bacterial surface-active antimicrobial peptide-like region and a possible substrate-binding subdomain.
Resolution1.27 Å
Binding residue
(original residue number in PDB)
Q121 N125
Binding residue
(residue number reindexed from 1)
Q122 N126
Enzymatic activity
Enzyme Commision number ?
External links