Structure of PDB 7omy Chain AAA Binding Site BS01

Receptor Information
>7omy Chain AAA (length=209) Species: 1577051 (Thermus sp. 2.9) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKRTYPEPTPIYHITHIDNLKGILRMGKLLAHNQSPPKQRSIAYAHIQER
RNRAKVPQPPGGVLHDYVPFYFCPRSPMLYAIYSGATEYQGGQEPILHLV
SSAQAVHKAGLPFVFTDRHGVLSHARFFRQLEELAQLDWEAIQASYWADP
PELREKKQAAFLVYKAFPWALIEEIAVYSQRVGEEVLKILKQFPEARRPR
VCIRKDWYY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7omy Molecular basis for DarT ADP-ribosylation of a DNA base.
Resolution1.6 Å
Binding residue
(original residue number in PDB)		A43 Y44 H46 R51 R75 P77 M78 Y80 S84 A86 H119 S145 Y146 W147 A148 R154 Q158 Y209
Binding residue
(residue number reindexed from 1)		A43 Y44 H46 R51 R75 P77 M78 Y80 S84 A86 H119 S145 Y146 W147 A148 R154 Q158 Y209
Enzymatic activity
Enzyme Commision number 2.4.2.-
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0016757 glycosyltransferase activity
GO:0016779 nucleotidyltransferase activity

View graph for
Molecular Function
External links
PDB RCSB:7omy, PDBe:7omy, PDBj:7omy
PDBsum7omy
PubMed34408320
UniProtA0A0B0SG80|DART_THES0 DNA ADP-ribosyl transferase (Gene Name=darT)

[Back to BioLiP]