Structure of PDB 7nw1 Chain AAA Binding Site BS01

Receptor Information
>7nw1 Chain AAA (length=163) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DEATRRVVSEIPVLKTNAGPRDRELWVQRLKEEYQSLIRYVENNKNADND
WFRLESNKEGTRWFGKCWYIHDLLKYEFDIEFDIPITYPTTAPEIAVPEL
DGKTAKMYRGGKICLTDHFKPLWARNVPKFGLAHLMALGLGPWLAVEIPD
LIQKGVIQHKEKC
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7nw1 Structural basis for UFM1 transfer from UBA5 to UFC1.
Resolution1.95 Å
Binding residue
(original residue number in PDB)		I72 H73 D74 L75
Binding residue
(residue number reindexed from 1)		I70 H71 D72 L73
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0061657 UFM1 conjugating enzyme activity
GO:0071568 UFM1 transferase activity
Biological Process
GO:0007420 brain development
GO:0032649 regulation of type II interferon production
GO:0034976 response to endoplasmic reticulum stress
GO:0061709 reticulophagy
GO:0071569 protein ufmylation
GO:1990592 protein K69-linked ufmylation
Cellular Component
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7nw1, PDBe:7nw1, PDBj:7nw1
PDBsum7nw1
PubMed34588452
UniProtQ9Y3C8|UFC1_HUMAN Ubiquitin-fold modifier-conjugating enzyme 1 (Gene Name=UFC1)

[Back to BioLiP]