Structure of PDB 7nsx Chain AAA Binding Site BS01

Receptor Information

>7nsx Chain AAA (length=170) Species: 7227 (Drosophila melanogaster)

TARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVCYSTPDCMKSMR
DMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAHAPKYNDKSVGI
VLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLLGHRQVRDTECP
GGRLFAEISSWPHFTHINDT

Ligand information

• Ligand ID: ZN
• InChI: InChI=1S/Zn/q+2
• InChIKey: PTFCDOFLOPIGGS-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Zn++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Zn+2]
• Formula: Zn
• Name: ZINC ION
• ChEMBL: CHEMBL1236970
• DrugBank: DB14532
• PDB chain: 7nsx Chain AAA Residue 2000

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7nsx PGRP-LB: An Inside View into the Mechanism of the Amidase Reaction.
• Resolution: 1.9 Å
• Binding residue (original residue number in PDB): H42 H152 C160
• Binding residue (residue number reindexed from 1): H31 H141 C149
• Annotation score: 4

Enzymatic activity

• Enzyme Commision number: 3.5.1.28: N-acetylmuramoyl-L-alanine amidase.

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0008270 zinc ion binding
• GO:0008745 N-acetylmuramoyl-L-alanine amidase activity
• GO:0016787 hydrolase activity
• GO:0042834 peptidoglycan binding
• GO:0046872 metal ion binding

Biological Process

• GO:0002814 negative regulation of biosynthetic process of antibacterial peptides active against Gram-negative bacteria
• GO:0009253 peptidoglycan catabolic process
• GO:0045087 innate immune response
• GO:0050830 defense response to Gram-positive bacterium
• GO:0061060 negative regulation of peptidoglycan recognition protein signaling pathway

Cellular Component

• GO:0005576 extracellular region

External links

• PDB: RCSB:7nsx, PDBe:7nsx, PDBj:7nsx
• PDBsum: 7nsx
• PubMed: 34066955
• UniProt: Q8INK6|PGPLB_DROME Peptidoglycan-recognition protein LB (Gene Name=PGRP-LB)