Structure of PDB 7bbp Chain AAA Binding Site BS01

Receptor Information
>7bbp Chain AAA (length=117) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YDIQAWKKQCEELLNLIFQCEDSEPFRQPVDLLEYPDYRDIIDTPMDFAT
VRETLEAGNYESPMELCKDVRLIFSNSKAYTPSKRSRIYSMSLRLSAFFE
EHISSVLSDYKSALRFH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7bbp Crystal Structure of the second bromodomain of Pleckstrin homology domain interacting protein (PHIP) in complex with H4K5acK8ac
Resolution1.99 Å
Binding residue
(original residue number in PDB)
V1345 Y1350 Y1395 T1396
Binding residue
(residue number reindexed from 1)
V30 Y35 Y80 T81
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7bbp, PDBe:7bbp, PDBj:7bbp
PDBsum7bbp
PubMed
UniProtQ8WWQ0|PHIP_HUMAN PH-interacting protein (Gene Name=PHIP)

[Back to BioLiP]