Structure of PDB 6y8k Chain AAA Binding Site BS01

Receptor Information
>6y8k Chain AAA (length=130) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DPCSNCPAGTFCDICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSS
TSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCSFGTFNDQKR
GICRPWTDCSLDGKSVLVDGTKERDVVCGP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6y8k Anticancer immunity induced by a synthetic tumor-targeted CD137 agonist.
Resolution2.011 Å
Binding residue
(original residue number in PDB)
I64 R66 V71 F72 N83 S100 M101 C102 Q104 K114 K115 G116
Binding residue
(residue number reindexed from 1)
I34 R36 V41 F42 N53 S70 M71 C72 Q74 K84 K85 G86
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6y8k, PDBe:6y8k, PDBj:6y8k
PDBsum6y8k
PubMed33500260
UniProtQ07011|TNR9_HUMAN Tumor necrosis factor receptor superfamily member 9 (Gene Name=TNFRSF9)

[Back to BioLiP]