Structure of PDB 6v41 Chain AAA Binding Site BS01

Receptor Information
>6v41 Chain AAA (length=61) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ASQEFEVEAIVDKRQDKNGNTQYLVRWKGYDKQDDTWEPEQHLMNCEKCV
HDFNRRQTEKQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6v41 Structural Basis for the Binding Selectivity of Human CDY Chromodomains.
Resolution1.603 Å
Binding residue
(original residue number in PDB)
Q4 E5 F6 E7 V8 W28 Y31 E39 H43 N46 C47 C50
Binding residue
(residue number reindexed from 1)
Q3 E4 F5 E6 V7 W27 Y30 E38 H42 N45 C46 C49
Enzymatic activity
Enzyme Commision number 2.3.1.48: histone acetyltransferase.
External links
PDB RCSB:6v41, PDBe:6v41, PDBj:6v41
PDBsum6v41
PubMed32470319
UniProtQ9Y6F8|CDY1_HUMAN Testis-specific chromodomain protein Y 1 (Gene Name=CDY1)

[Back to BioLiP]