Structure of PDB 6txs Chain AAA Binding Site BS01

Receptor Information

>6txs Chain AAA (length=340) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

KTISVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWFFGLQYQDT
KGFSTWLKLNKKVTAQDVRKESPLLFKFRAKFYPEDVSEELIQDITQRLF
FLQVKEGILNDDIYCPPETAVLLASYAVQSKYGDFNKEVHKSGYLAGDKL
LPQRVLEQHKLNKDQWEERIQVWHEEHRGMLREDAVLEYLKIAQDLEMYG
VNYFSIKNKKGSELWLGVDALGLNIYEQNDRLTPKIGFPWSEIRNISFND
KKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTIEV
QQMKAQAREEKHQKQMERAMLENEKKKREMAEKEKEKIER

Ligand information

>6txs Chain BBB (length=8) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

QKKKLVIN

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6txs The structure of the FERM domain and helical linker of human moesin bound to a CD44 peptide
Resolution	2.2 Å
Binding residue (original residue number in PDB)	W242 I245 R246 N247 I248 S249 F250 N251 D252 K278 L281 M285 H288
Binding residue (residue number reindexed from 1)	W240 I243 R244 N245 I246 S247 F248 N249 D250 K276 L279 M283 H286

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003779	actin binding
GO:0008092	cytoskeletal protein binding

	Cellular Component
GO:0005856	cytoskeleton

View graph for
Molecular Function

View graph for
Cellular Component

External links

PDB	RCSB:6txs, PDBe:6txs, PDBj:6txs
PDBsum	6txs
PubMed	37866628
UniProt	P26038\|MOES_HUMAN Moesin (Gene Name=MSN)

[Back to BioLiP]