Structure of PDB 8q2m Chain AA Binding Site BS01

Receptor Information
>8q2m Chain AA (length=63) Species: 2285 (Sulfolobus acidocaldarius) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MVKVKFKYKGEEKEVDTSKIKKVWRAGKAVSFTYDDNGKTGRGAVSEKDA
PKELLDMLARAER
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8q2m 18mer DNA mimic foldamer with Alphatic linker in complex with Sac7d wild protein.
Resolution3.21 Å
Binding residue
(original residue number in PDB)		K7 A26 G27 A29 S31 R42 G43 A44 V45
Binding residue
(residue number reindexed from 1)		K7 A26 G27 A29 S31 R42 G43 A44 V45
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004521 RNA endonuclease activity
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8q2m, PDBe:8q2m, PDBj:8q2m
PDBsum8q2m
PubMed
UniProtP13123|DN7D_SULAC DNA-binding protein 7d (Gene Name=Saci_0064)

[Back to BioLiP]