Structure of PDB 8cmn Chain AA Binding Site BS01

Receptor Information
>8cmn Chain AA (length=63) Species: 330779 (Sulfolobus acidocaldarius DSM 639) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MVKVKFKYKGEEKEVDTSKIKKVWRVGKMVSFTYDDNGKTGRGAVSEKDA
PKELLDMLARAER
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8cmn 18mer DNA mimic Foldamer with an aliphatic linker in complex with Sac7d wild protein
Resolution2.65 Å
Binding residue
(original residue number in PDB)		K7 Y8 K9 G10 V26 G27 K28 M29 S31 R42 G43 A44
Binding residue
(residue number reindexed from 1)		K7 Y8 K9 G10 V26 G27 K28 M29 S31 R42 G43 A44
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004521 RNA endonuclease activity
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8cmn, PDBe:8cmn, PDBj:8cmn
PDBsum8cmn
PubMed
UniProtP13123|DN7D_SULAC DNA-binding protein 7d (Gene Name=Saci_0064)

[Back to BioLiP]