Structure of PDB 7q9h Chain AA Binding Site BS01

Receptor Information

>7q9h Chain AA (length=221) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

LPKSVDWRKKGYVTPVKNQKQCGSAWAFSATGALEGQMFRKTGKLVSLSE
QNLVDCSRPQGNQGCNGGFMARAFQYVKENGGLDSEESYPYVAVDEICKY
RPENSVAQDTGFTVVAPGKEKALMKAVATVGPISVAMDAGHSSFQFYKSG
IYFEPDCSSKNLDHGVLVVGYGFEGANSQNSKYWLVKNSWGPEWGSNGYV
KIAKDKNNHCGIATAASYPNV

Ligand information

>7q9h Chain PAA (length=3) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

LLK

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7q9h Proteomic data and structure analysis combined reveal interplay of structural rigidity and flexibility on selectivity of cysteine cathepsins.
Resolution	1.4 Å
Binding residue (original residue number in PDB)	A25 Q63 G67 G68 F69 D163 H164
Binding residue (residue number reindexed from 1)	A25 Q63 G67 G68 F69 D163 H164

Enzymatic activity

Enzyme Commision number

3.4.22.43: cathepsin V.

Gene Ontology

	Molecular Function
GO:0008234	cysteine-type peptidase activity

	Biological Process
GO:0006508	proteolysis

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:7q9h, PDBe:7q9h, PDBj:7q9h
PDBsum	7q9h
PubMed	37095140
UniProt	O60911\|CATL2_HUMAN Cathepsin L2 (Gene Name=CTSV)

[Back to BioLiP]