Structure of PDB 7q9c Chain AA Binding Site BS01

Receptor Information

>7q9c Chain AA (length=221) Species: 9606 (Homo sapiens)

LPKSVDWRKKGYVTPVKNQKQCGSAWAFSATGALEGQMFRKTGKLVSLSE
QNLVDCSRPQGNQGCNGGFMARAFQYVKENGGLDSEESYPYVAVDEICKY
RPENSVAQDTGFTVVAPGKEKALMKAVATVGPISVAMDAGHSSFQFYKSG
IYFEPDCSSKNLDHGVLVVGYGFEGANSQNSKYWLVKNSWGPEWGSNGYV
KIAKDKNNHCGIATAASYPNV

Ligand information

>7q9c Chain PAA (length=3) Species: 9606 (Homo sapiens)

RLS

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7q9c Proteomic data and structure analysis combined reveal interplay of structural rigidity and flexibility on selectivity of cysteine cathepsins.
• Resolution: 1.4 Å
• Binding residue (original residue number in PDB): A25 G67 G68 F69 M70 D163 H164
• Binding residue (residue number reindexed from 1): A25 G67 G68 F69 M70 D163 H164

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Fri Nov 29 03:13:22 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1435     title=pdb2title(pdbid)

   1436     if bs.startswith("BS"):

=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)

   1438     else:

   1439         if lig3:

pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '7q9c', asym_id = 'AA', bs = 'BS01', title = 'Proteomic data and structure analysis combined r...exibility on selectivity of cysteine cathepsins. '

 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='7q9c', asym_id='AA', bs='BS01', title='Proteomic data and structure analysis combined r...exibility on selectivity of cysteine cathepsins. ')

   1295         display_ec(ec,csaOrig,csaRenu)

   1296     if go:

=> 1297         display_go(go,uniprot,pdbid,asym_id)

   1298     return pubmed,uniprot

   1299 

global display_go = <function display_go>, go = '0006508,0008234', uniprot = '', pdbid = '7q9c', asym_id = 'AA'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0006508,0008234', uniprot='', pdbid='7q9c', asym_id='AA')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>