Structure of PDB 7q8p Chain AA Binding Site BS01

Receptor Information

>7q8p Chain AA (length=222) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DLPKSVDWRKKGYVTPVKNQKQCGSSWAFSATGALEGQMFRKTGKLVSLS
EQNLVDCSRPQGNQGCNGGFMARAFQYVKENGGLDSEESYPYVAVDEICK
YRPENSVAQDTGFTVVAPGKEKALMKAVATVGPISVAMDAGHSSFQFYKS
GIYFEPDCSSKNLDHGVLVVGYGFEGANSQNSKYWLVKNSWGPEWGSNGY
VKIAKDKNNHCGIATAASYPNV

Ligand information

>7q8p Chain PA (length=4) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

LLKV

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7q8p Proteomic data and structure analysis combined reveal interplay of structural rigidity and flexibility on selectivity of cysteine cathepsins.
Resolution	1.71 Å
Binding residue (original residue number in PDB)	Q22 C23 G24 G141 Q146 D164 H165 W191
Binding residue (residue number reindexed from 1)	Q22 C23 G24 G141 Q146 D164 H165 W191

Enzymatic activity

Enzyme Commision number

3.4.22.43: cathepsin V.

Gene Ontology

	Molecular Function
GO:0008234	cysteine-type peptidase activity

	Biological Process
GO:0006508	proteolysis

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:7q8p, PDBe:7q8p, PDBj:7q8p
PDBsum	7q8p
PubMed	37095140
UniProt	O60911\|CATL2_HUMAN Cathepsin L2 (Gene Name=CTSV)

[Back to BioLiP]