Structure of PDB 7q8i Chain AA Binding Site BS01

Receptor Information

>7q8i Chain AA (length=222) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DLPKSVDWRKKGYVTPVKNQKQCGSSWAFSATGALEGQMFRKTGKLVSLS
EQNLVDCSRPQGNQGCNGGFMARAFQYVKENGGLDSEESYPYVAVDEICK
YRPENSVAQDTGFTVVAPGKEKALMKAVATVGPISVAMDAGHSSFQFYKS
GIYFEPDCSSKNLDHGVLVVGYGFEGANSQNSKYWLVKNSWGPEWGSNGY
VKIAKDKNNHCGIATAASYPNV

Ligand information

>7q8i Chain PA (length=5) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

AVAEK

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7q8i Proteomic data and structure analysis combined reveal interplay of structural rigidity and flexibility on selectivity of cysteine cathepsins.
Resolution	1.59 Å
Binding residue (original residue number in PDB)	Q20 C23 Q146 H165 W191
Binding residue (residue number reindexed from 1)	Q20 C23 Q146 H165 W191

Enzymatic activity

Enzyme Commision number

3.4.22.43: cathepsin V.

Gene Ontology

	Molecular Function
GO:0008234	cysteine-type peptidase activity

	Biological Process
GO:0006508	proteolysis

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:7q8i, PDBe:7q8i, PDBj:7q8i
PDBsum	7q8i
PubMed	37095140
UniProt	O60911\|CATL2_HUMAN Cathepsin L2 (Gene Name=CTSV)

[Back to BioLiP]