Structure of PDB 6lqv Chain A9 Binding Site BS01

Receptor Information
>6lqv Chain A9 (length=128) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NILSSHLEANSTEILDDLMSGSWTEPEIKKFILTKINTVDHLSKIFLTIS
KSITQNPWNEENLLPLWLKWLLTLKSGELNSIKDKHTKKNCKHLKSALRS
SEEILPVLLGIQGRLEMLRRQAKLREDL
Ligand information
>6lqv Chain 5A (length=171) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ugcgaaagcaguugaagacaaguggcuugucguucguuaauggccucguc
cagcgaaggauuugguggauuacuagcuaauagcaaucuaggaaacucaa
agagugcuaugguauggugacggagugcgcugugaacagagagcauuucc
ggcagcagagauuucagcugu
<<<....>>>...<<<<<<<<<<.>>>>>>>.>>>...............
.........................<<<...>>>................
....................<<<<.<<<.<<......>>...>>>..>>>
><<<<<.<<<..>>>.>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6lqv Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.
Resolution4.8 Å
Binding residue
(original residue number in PDB)		K483 S484 R487
Binding residue
(residue number reindexed from 1)		K95 S96 R99
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0005515 protein binding
GO:0034511 U3 snoRNA binding
Biological Process
GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006364 rRNA processing
GO:0030490 maturation of SSU-rRNA
GO:0042254 ribosome biogenesis
GO:0045943 positive regulation of transcription by RNA polymerase I
GO:0071528 tRNA re-export from nucleus
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0030686 90S preribosome
GO:0032040 small-subunit processome
GO:0033553 rDNA heterochromatin
GO:0034455 t-UTP complex
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6lqv, PDBe:6lqv, PDBj:6lqv
PDBsum6lqv
PubMed32943522
UniProtP38882|UTP9_YEAST U3 small nucleolar RNA-associated protein 9 (Gene Name=UTP9)

[Back to BioLiP]