Structure of PDB 6x89 Chain A7 Binding Site BS01

Receptor Information
>6x89 Chain A7 (length=109) Species: 157791 (Vigna radiata) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KPWEITGPCADPEYRSAVPLATEYRLQCPATTKEKPCIPNSLPETVYDIK
YFSRDQRRNRPPIRRTVLKKADVEKLAKEQTFAVSDFPPVYLNSAVEEDI
NAIGGGYQG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6x89 Atomic structure of a mitochondrial complex I intermediate from vascular plants.
Resolution3.9 Å
Binding residue
(original residue number in PDB)
V114 E115 E116
Binding residue
(residue number reindexed from 1)
V96 E97 E98
Enzymatic activity
Enzyme Commision number ?
External links