Structure of PDB 6q9d Chain A7 Binding Site BS01

Receptor Information
>6q9d Chain A7 (length=96) Species: 9940 (Ovis aries) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ASATRLIQGLRNWASGRDLQAKLQLRYQEISKRTQPPPKLPVGPSHRLSN
NYYCARDGRREAMPPSIVMSSQSEKKAVSPAPPIKRWELSQDEPYL
Ligand information
>6q9d Chain AM (length=23) Species: 9940 (Ovis aries) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
VKQDMPPVGGYGPIDYKRNLPRR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6q9d Structures of Respiratory Supercomplex I+III2Reveal Functional and Conformational Crosstalk.
Resolution3.8 Å
Binding residue
(original residue number in PDB)		R17 P38 K39 P41 D108 E109
Binding residue
(residue number reindexed from 1)		R17 P38 K39 P41 D92 E93
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006120 mitochondrial electron transport, NADH to ubiquinone
GO:0042773 ATP synthesis coupled electron transport
Cellular Component
GO:0005743 mitochondrial inner membrane
GO:0016020 membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6q9d, PDBe:6q9d, PDBj:6q9d
PDBsum6q9d
PubMed31492636
UniProtW5P0I2

[Back to BioLiP]