Structure of PDB 8wo5 Chain A6 Binding Site BS01

Receptor Information
>8wo5 Chain A6 (length=134) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DRLDAALRFQQEALNLRAQRQEILAANIANADTPGYQARDIDFASELKKV
MVRGREETGGVALTLTSSHHIPAQAVSSPAVDLLYRVPDQPSLDGNTVDM
DRERTQFADNSLKYQMGLTVLGSQLKGMMNVLQG
Ligand information
>8wo5 Chain BH (length=16) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PGGVPGALSNQPAPPN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8wo5 Cryo-EM structure of the intact flagellar motor-hook complex in the CCW state
Resolution7.4 Å
Binding residue
(original residue number in PDB)		P36 L95 D96
Binding residue
(residue number reindexed from 1)		P34 L93 D94
External links
PDB RCSB:8wo5, PDBe:8wo5, PDBj:8wo5
PDBsum8wo5
PubMed
UniProtP16437|FLGB_SALTY Flagellar basal body rod protein FlgB (Gene Name=flgB)

[Back to BioLiP]