Structure of PDB 8woe Chain A5 Binding Site BS01

Receptor Information
>8woe Chain A5 (length=92) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AIQGIEGVISQLQATAMAAVSFAGQLHAALDRISDRQAAARVQAEKFTLG
EPGIALNDVMADMQKASVSMQMGIQVRNKLVAAYQEVMSMQV
Ligand information
>8woe Chain BG (length=13) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GGVPGALSNQPAP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8woe Cryo-EM structure of the intact flagellar motor-hook complex in the CW state
Resolution4.3 Å
Binding residue
(original residue number in PDB)		F59 G62 E63 P64 I66 N69
Binding residue
(residue number reindexed from 1)		F47 G50 E51 P52 I54 N57
External links
PDB RCSB:8woe, PDBe:8woe, PDBj:8woe
PDBsum8woe
PubMed
UniProtP26462|FLIE_SALTY Flagellar hook-basal body complex protein FliE (Gene Name=fliE)

[Back to BioLiP]