Structure of PDB 8ckb Chain A286 Binding Site BS01

Receptor Information
>8ckb Chain A286 (length=333) Species: 2301731 (Bacteroides phage crAss001) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MVISINQVRQLYVAKALKANTAALTTAGDIVPKADTAKTTLYFQSMSPAG
IVASDKINLKHVLYAKATPSEALAHKLVRYSVTLDADVSATPVAGQNYIL
RLAFRQYIGLSEEDQYFKYGEVIARSGMTASDFYKKMAISLAKNLENKTE
STPLVNIYLISAAAASTDVPVTSATKESDLTATDYNQIIIEETEQPWVLG
MMPQAFIPFTPQFLTITVDGEDRLWGVATVVTPTKTVPDGHLIADLEYFC
MGARGDIYRGMGYPNIIKTTYLVDPGAVYDVLDIHYFYTGSNESVQKSEK
TITLVAVDDGSHTAMNALIGAINTASGLTIATL
Ligand information
>8ckb Chain A511 (length=24) Species: 2301731 (Bacteroides phage crAss001) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
VQKSEKTITLVAVDDGSHTAMNAL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ckb Structural atlas of the most abundant human gut virus
Resolution4.39 Å
Binding residue
(original residue number in PDB)		N6 Q7 R9 Q10 L11 Y12 A14 L17 P69 S70 E71 I243 V278 Y279 D280 V281 L282 D283 I284 H285 Y286 F287 Y288 E293 S294 V295 Q296 K297 S298 E299 K300 T301 I302 T303 L304 V305 A306 V307 D308 D309 G310 S311 H312 T313 A314 M315 N316 A317 L318 I319 G320 T332 L333
Binding residue
(residue number reindexed from 1)		N6 Q7 R9 Q10 L11 Y12 A14 L17 P69 S70 E71 I243 V278 Y279 D280 V281 L282 D283 I284 H285 Y286 F287 Y288 E293 S294 V295 Q296 K297 S298 E299 K300 T301 I302 T303 L304 V305 A306 V307 D308 D309 G310 S311 H312 T313 A314 M315 N316 A317 L318 I319 G320 T332 L333
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0019028 viral capsid
GO:0098021 viral capsid, decoration

View graph for
Cellular Component
External links
PDB RCSB:8ckb, PDBe:8ckb, PDBj:8ckb
PDBsum8ckb
PubMed
UniProtA0A385DVS7|AUXCP_BPCA1 Auxiliary capsid protein (Gene Name=crAss001_36)

[Back to BioLiP]