Structure of PDB 8ckb Chain A250 Binding Site BS01

Receptor Information
>8ckb Chain A250 (length=333) Species: 2301731 (Bacteroides phage crAss001) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MVISINQVRQLYVAKALKANTAALTTAGDIVPKADTAKTTLYFQSMSPAG
IVASDKINLKHVLYAKATPSEALAHKLVRYSVTLDADVSATPVAGQNYIL
RLAFRQYIGLSEEDQYFKYGEVIARSGMTASDFYKKMAISLAKNLENKTE
STPLVNIYLISAAAASTDVPVTSATKESDLTATDYNQIIIEETEQPWVLG
MMPQAFIPFTPQFLTITVDGEDRLWGVATVVTPTKTVPDGHLIADLEYFC
MGARGDIYRGMGYPNIIKTTYLVDPGAVYDVLDIHYFYTGSNESVQKSEK
TITLVAVDDGSHTAMNALIGAINTASGLTIATL
Ligand information
>8ckb Chain A507 (length=17) Species: 2301731 (Bacteroides phage crAss001) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
MVISINQVRQLYVAKAL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ckb Structural atlas of the most abundant human gut virus
Resolution4.39 Å
Binding residue
(original residue number in PDB)		M1 V2 I3 S4 I5 N6 Q7 V8 R9 Q10 L11 Y12 V13 A14 K15 A16 L17 K18 A27 G28 D29 I30 S54 D245 C250 D283 H285 E299 T301 I302 T303 L304 V305 A306 L318
Binding residue
(residue number reindexed from 1)		M1 V2 I3 S4 I5 N6 Q7 V8 R9 Q10 L11 Y12 V13 A14 K15 A16 L17 K18 A27 G28 D29 I30 S54 D245 C250 D283 H285 E299 T301 I302 T303 L304 V305 A306 L318
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0019028 viral capsid
GO:0098021 viral capsid, decoration

View graph for
Cellular Component
External links
PDB RCSB:8ckb, PDBe:8ckb, PDBj:8ckb
PDBsum8ckb
PubMed
UniProtA0A385DVS7|AUXCP_BPCA1 Auxiliary capsid protein (Gene Name=crAss001_36)

[Back to BioLiP]