Structure of PDB 9pcy Chain A Binding Site BS01

Receptor Information

>9pcy Chain A (length=99) Species: 3885 (Phaseolus vulgaris)

LEVLLGSGDGSLVFVPSEFSVPSGEKIVFKNNAGFPHNVVFDEDEIPAGV
DAVKISMPEEELLNAPGETYVVTLDTKGTYSFYCSPHQGAGMVGKVTVN

Ligand information

• Ligand ID: CU
• InChI: InChI=1S/Cu/q+2
• InChIKey: JPVYNHNXODAKFH-UHFFFAOYSA-N
• SMILES:
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Cu+2]
  CACTVS 3.341: [Cu++]
• Formula: Cu
• Name: COPPER (II) ION
• DrugBank: DB14552
• PDB chain: 9pcy Chain A Residue 100

Receptor-Ligand Complex Structure

Structure summary

• PDB: 9pcy High-resolution solution structure of reduced French bean plastocyanin and comparison with the crystal structure of poplar plastocyanin.
• Resolution: N/A
• Binding residue (original residue number in PDB): H37 C84 H87
• Binding residue (residue number reindexed from 1): H37 C84 H87
• Annotation score: 3

Enzymatic activity

• Catalytic site (original residue number in PDB): H37 C84 H87 M92
• Catalytic site (residue number reindexed from 1): H37 C84 H87 M92

Gene Ontology

Molecular Function

• GO:0005507 copper ion binding
• GO:0009055 electron transfer activity
• GO:0046028 electron transporter, transferring electrons from cytochrome b6/f complex of photosystem II activity
• GO:0046872 metal ion binding

Cellular Component

• GO:0009507 chloroplast
• GO:0009535 chloroplast thylakoid membrane
• GO:0009543 chloroplast thylakoid lumen
• GO:0009579 thylakoid
• GO:0016020 membrane

External links

• PDB: RCSB:9pcy, PDBe:9pcy, PDBj:9pcy
• PDBsum: 9pcy
• PubMed: 1920431
• UniProt: P00287|PLAS_PHAVU Plastocyanin (Gene Name=PETE)