Structure of PDB 9ild Chain A Binding Site BS01

Receptor Information
>9ild Chain A (length=152) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MNELVFIDDFDNHVVIMSEVVMRLNSYRQTHYTSTESGGTLIGERRGQHL
VITHISEPGQDDVRNRTGLERKGIHHQQKVNDLFQQSNGFIVYLGEWHTH
PEDFPHPSFIDIKSWVMGIVATEPMIMLIVGRKDIWIGKKIKNDIKKLKK
KM
Ligand information
>9ild Chain B (length=26) Species: 562 (Escherichia coli) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
IAAAPAFHVSPSREPEPRKINKTMVS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB9ild Structural and functional characterization of the bacterial Cap3 enzyme in deconjugation and regulation of the cyclic dinucleotide transferase CD-NTase
Resolution2.179 Å
Binding residue
(original residue number in PDB)		V7 H15 V17 E38 R47 R48 G49 H51 L71 R73 H78 Q79 F86 N90 G91 F92 V94 Y95 E98 H100 D113 S116 G120 V122 M127 K153
Binding residue
(residue number reindexed from 1)		V5 H13 V15 E36 R45 R46 G47 H49 L69 R71 H76 Q77 F84 N88 G89 F90 V92 Y93 E96 H98 D111 S114 G118 V120 M125 K151
Gene Ontology
Molecular Function
GO:0008237 metallopeptidase activity
GO:0046872 metal ion binding
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:9ild, PDBe:9ild, PDBj:9ild
PDBsum9ild
PubMed
UniProtA0A3J1GR98

[Back to BioLiP]