Structure of PDB 9gpj Chain A Binding Site BS01

Receptor Information
>9gpj Chain A (length=184) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRG
FGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKK
IFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDH
DSVDKIVIQKYHTVNGHNCEVRKALSKQEMASAS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB9gpj Structure of UP1 S4DS6D phosphomimetic mutant in complex with human telomeric repeat DNA
Resolution1.53 Å
Binding residue
(original residue number in PDB)		Q12 K15 F17 G19 G20 D42 V44 M46 R55 G56 F57 F59 E85 K87 A89 V90 R92 S95 H101
Binding residue
(residue number reindexed from 1)		Q6 K9 F11 G13 G14 D36 V38 M40 R49 G50 F51 F53 E79 K81 A83 V84 R86 S89 H95
External links
PDB RCSB:9gpj, PDBe:9gpj, PDBj:9gpj
PDBsum9gpj
PubMed
UniProtP09651|ROA1_HUMAN Heterogeneous nuclear ribonucleoprotein A1 (Gene Name=HNRNPA1)

[Back to BioLiP]