Structure of PDB 9g13 Chain A Binding Site BS01

Receptor Information
>9g13 Chain A (length=126) Species: 9844 (Lama glama) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QLQASGGGFVQPGGSLRLSCAASGYTSGDEIMGWFRQAPGKEREFVSAIS
WQSGTSTYYADSVKGRFTISRDNSKNTVYLQMNSLRAEDTATYYCAPMTL
AETYYEWLISGYWGQGTQVTVSSAAA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB9g13 VHH H3-2 in complex with Tau C-terminal peptide
Resolution1.8 Å
Binding residue
(original residue number in PDB)		E106 T107 Y108 Y109 E110 W111 L112 I113 S114
Binding residue
(residue number reindexed from 1)		E102 T103 Y104 Y105 E106 W107 L108 I109 S110
External links