Structure of PDB 9c66 Chain A Binding Site BS01

Receptor Information
>9c66 Chain A (length=112) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SEQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNTFRVVGR
KIQDHQVVINCAIPKGLKYNQATQTFHQWRDARQVYGLNFGSKEDANVFA
SAMMHALEVLNS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB9c66 Insights into the Interaction Landscape of the EVH1 Domain of Mena.
Resolution1.4 Å
Binding residue
(original residue number in PDB)
Y16 W23 F77 Q79
Binding residue
(residue number reindexed from 1)
Y15 W22 F76 Q78
External links
PDB RCSB:9c66, PDBe:9c66, PDBj:9c66
PDBsum9c66
PubMed39138154
UniProtQ8N8S7|ENAH_HUMAN Protein enabled homolog (Gene Name=ENAH)

[Back to BioLiP]