Structure of PDB 9b9l Chain A Binding Site BS01

Receptor Information
>9b9l Chain A (length=127) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SFSESALEKKLSELSNSQHSVQTLSLWLIHHRKHAGPIVSVWHRELRKAK
SNRKLTFLYLANDVIQNSKRKGPEFTREFESVLVDAFSHVAREADEGCKK
PLERLLNIWQERSVYGGEFIQQLKLSM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB9b9l Thr4 phosphorylation primes Ser2 phosphorylation on RNA polymerase II and mediates regulation in elongation and 3'end processing
Resolution2.5 Å
Binding residue
(original residue number in PDB)		N16 S17 Q18 V21 Y59 N62 D63 Q66 I108 R112
Binding residue
(residue number reindexed from 1)		N16 S17 Q18 V21 Y59 N62 D63 Q66 I108 R112
External links
PDB RCSB:9b9l, PDBe:9b9l, PDBj:9b9l
PDBsum9b9l
PubMed
UniProtQ9NQG5|RPR1B_HUMAN Regulation of nuclear pre-mRNA domain-containing protein 1B (Gene Name=RPRD1B)

[Back to BioLiP]