Structure of PDB 9b8u Chain A Binding Site BS01

Receptor Information
>9b8u Chain A (length=59) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RERTTFTRSQLEELEALFAKTQYPDVYAREEVALKINLPESRVQVWFKNR
RAKCRQQRQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB9b8u Molecular basis of CRX homeodomain/DNA binding and stoichiometry at the Ret4 cis-regulatory element in rhodopsin promoter
Resolution2.9 Å
Binding residue
(original residue number in PDB)		E42 R43 Y63 Q84 K88 R91 R95
Binding residue
(residue number reindexed from 1)		E2 R3 Y23 Q44 K48 R51 R55
External links
PDB RCSB:9b8u, PDBe:9b8u, PDBj:9b8u
PDBsum9b8u
PubMed39084215
UniProtO43186|CRX_HUMAN Cone-rod homeobox protein (Gene Name=CRX)

[Back to BioLiP]