Structure of PDB 9atn Chain A Binding Site BS01

Receptor Information
>9atn Chain A (length=98) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSARCAVCEGPGELCDLFFCTSCGHHYHGACLDTALTARKRAGWQCPECK
VCQACRKPGNDSKMLVCETCDKGYHTFCLKPPMEELPAHSWKCKACRV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB9atn ASXLs binding to the PHD2/3 fingers of MLL4 provides a mechanism for the recruitment of BAP1 to active enhancers.
ResolutionN/A
Binding residue
(original residue number in PDB)		V231 C255 L256 D257 P271 K274 D285 M288 V290 E292 A312 H313 S314 K316
Binding residue
(residue number reindexed from 1)		V7 C31 L32 D33 P47 K50 D61 M64 V66 E68 A88 H89 S90 K92
External links
PDB RCSB:9atn, PDBe:9atn, PDBj:9atn
PDBsum9atn
PubMed38849395
UniProtO14686|KMT2D_HUMAN Histone-lysine N-methyltransferase 2D (Gene Name=KMT2D)

[Back to BioLiP]