Structure of PDB 8zv9 Chain A Binding Site BS01

Receptor Information
>8zv9 Chain A (length=266) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SVDGSHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEP
RAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQM
MFGCDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKW
EAAHVAEQQRAYLEGTCVDGLRRYLENGKETLQRTDPPKTHMTHHPLRCW
ALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVGEEQRYT
CHVQHEGLPKPLTLRW
Ligand information
>8zv9 Chain C (length=9) Species: 2697049 (Severe acute respiratory syndrome coronavirus 2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NYNYLFRLF
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8zv9 Structural insights into immune escape at killer T cell epitope by SARS-CoV-2 Spike Y453F variants.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		Y7 E63 K66 V67 H70 T73 N77 Y84 F99 Y116 Y123 T143 W147 A150 V152 Q156 Y159 T163 Y171
Binding residue
(residue number reindexed from 1)		Y10 E66 K69 V70 H73 T76 N80 Y87 F102 Y119 Y126 T146 W150 A153 V155 Q159 Y162 T166 Y174
External links