Structure of PDB 8zbe Chain A Binding Site BS01

Receptor Information

>8zbe Chain A (length=263) Species: 9606 (Homo sapiens)

LVPVLYLLVCAAGLGGNTLVIYVVLRFAKMKTVTNIYILNLAVADVLYML
GLPFLATQNAASFWPFGPVLCRLVMTLDGVNQFTSVFCLTVMSVDRYLAV
VHPLSSARWRRPRVAKLASAAAWVLSLCMSLPLLVFADVQCNASWPEPVG
LWGAVFIIYTAVLGFFAPLLVICLCYLLIVVKVRRRRSERKVTRMVLVVV
LVFAGCWLPFFTVNIVNLAVALPQEPASAGLYFFVVILSYANSCANPVLY
GFLSDNFRQSFQK

Ligand information

>8zbe Chain P (length=6) Species: 32630 (synthetic construct)

CFWKTC

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8zbe Structural insights into somatostatin receptor 5 bound with cyclic peptides.
• Resolution: 3.24 Å
• Binding residue (original residue number in PDB): Q123 N187 G198 T205 F264 N268 N271
• Binding residue (residue number reindexed from 1): Q82 N142 G153 T160 F210 N214 N217

Gene Ontology

Molecular Function

• GO:0004930 G protein-coupled receptor activity
• GO:0004994 somatostatin receptor activity
• GO:0005515 protein binding
• GO:0042923 neuropeptide binding

Biological Process

• GO:0007186 G protein-coupled receptor signaling pathway
• GO:0007187 G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger
• GO:0007218 neuropeptide signaling pathway
• GO:0008285 negative regulation of cell population proliferation
• GO:0032467 positive regulation of cytokinesis
• GO:0038170 somatostatin signaling pathway
• GO:0050796 regulation of insulin secretion
• GO:0071385 cellular response to glucocorticoid stimulus

Cellular Component

• GO:0005886 plasma membrane
• GO:0043005 neuron projection

External links

• PDB: RCSB:8zbe, PDBe:8zbe, PDBj:8zbe
• PDBsum: 8zbe
• PubMed: 38926478
• UniProt: P07550|ADRB2_HUMAN Beta-2 adrenergic receptor (Gene Name=ADRB2);
  P35346|SSR5_HUMAN Somatostatin receptor type 5 (Gene Name=SSTR5)