Structure of PDB 8z4l Chain A Binding Site BS01

Receptor Information
>8z4l Chain A (length=154) Species: 256318 (metagenome) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKTMKKIYVTMKTLSPLYTGEVRNKVLIPFKGALRSALEIMLKAKGENVC
DTGESRARPCGRCVTCSLFGSMGRAGRASVDFLISNDTKEEVIEGATFTA
TITISNPQEKDLSLIQSALKFIEENGIGGWLNKGYGRVSFEVKSEDVATD
RFLK
Ligand information
>8z4l Chain M (length=49) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
guuaaaacucuucucaugcuggauucgaaauuaggugcgcuucgcguuu
.................................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8z4l Structural basis for the activity of the type VII CRISPR-Cas system.
Resolution2.85 Å
Binding residue
(original residue number in PDB)		G21 E22 V23 P50 K52 G53 A54 S57 G91 S92 M93 A96 I173 G174 G175 W176 N178
Binding residue
(residue number reindexed from 1)		G20 E21 V22 P29 K31 G32 A33 S36 G70 S71 M72 A75 I127 G128 G129 W130 N132
External links