Structure of PDB 8yzs Chain A Binding Site BS01

Receptor Information
>8yzs Chain A (length=133) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AELINQIGNRCHPKLYDEGDPSEKLELVTGTNVYITRAQLMNCHVSAGTR
HKVLLRRLLASFFDRNTLANSCGTGIRSSTNDPRRKPLDSRVLHAVKYYC
QNFAPNFKESEMNAIAADMCTNARRVVRKSWMP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8yzs Structural basis of DNA recognition by BEN domain proteins reveals a role for oligomerization in unmethylated DNA selection by BANP.
Resolution2.31 Å
Binding residue
(original residue number in PDB)		R400 D462 N466 R472
Binding residue
(residue number reindexed from 1)		R56 D118 N122 R128
External links
PDB RCSB:8yzs, PDBe:8yzs, PDBj:8yzs
PDBsum8yzs
PubMed39225042
UniProtQ96RE7|NACC1_HUMAN Nucleus accumbens-associated protein 1 (Gene Name=NACC1)

[Back to BioLiP]